PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10022643m
Common NameCICLE_v10022641mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NF-YB
Protein Properties Length: 158aa    MW: 17360.7 Da    PI: 4.3597
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10022643mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB77.22.4e-241194386
            NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                     ++d+ lP a +++i+k++lPa+ ++++da++++ ec +efi +v+se+++ c re+++ti+++ +l al  lGf +y+e++ + 
  Ciclev10022643m 11 KEDASLPKATMTKIIKEMLPADVRVARDAQDLLIECCVEFINLVSSESNEVCSREDKRTIAPEHVLKALEVLGFGEYIEEVYAA 94
                     6899***************************************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.6E-398140IPR009072Histone-fold
SuperFamilySSF471132.35E-3512141IPR009072Histone-fold
PfamPF008082.3E-211479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MEPMDIVGKS KEDASLPKAT MTKIIKEMLP ADVRVARDAQ DLLIECCVEF INLVSSESNE  60
VCSREDKRTI APEHVLKALE VLGFGEYIEE VYAAYEQHKL ETMQDSLKGG KWSNGAEMTE  120
EEAAAEQQRM FAEARARMNG GAAGPPKQPD INPSLES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B1e-331213512133Transcription Regulator NC2 beta chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.201531e-157fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006440889.11e-114hypothetical protein CICLE_v10022641mg
RefseqXP_006440888.11e-114hypothetical protein CICLE_v10022641mg
RefseqXP_006494260.11e-114PREDICTED: protein Dr1 homolog isoform X1
SwissprotP495928e-94NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A067FDZ11e-114A0A067FDZ1_CITSI; Uncharacterized protein
TrEMBLV4T1V81e-114V4T1V8_9R
STRINGGLYMA05G07750.15e-99(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.23e-75nuclear factor Y, subunit B13